Recombinant Proteins
- (285)
- (11)
- (65,867)
- (1)
- (2)
- (970)
- (1)
- (23,540)
- (5)
- (1)
- (1)
- (67)
- (216)
- (4,420)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,448)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (157)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (253)
- (22,591)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,799)
- (253)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (105)
- (1)
- (3,750)
- (1,407)
- (3)
- (4)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (10)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,522)
- (2)
- (1)
- (160)
- (18)
- (48)
- (3)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (208)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,708)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,758)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (27,095)
- (235)
- (1)
- (3)
- (2)
- (1)
- (2)
- (1)
- (89)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,303)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (29,092)
- (5)
- (22)
- (8)
- (4)
- (1,291)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (8)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (233)
- (9)
- (2)
- (5)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (15)
- (1)
- (2)
- (45,208)
- (5,648)
- (245)
- (168)
- (56)
- (3,361)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (3)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (43,090)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ PGAM1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | PGAM1 |
| Molecular Weight (g/mol) | 30.9kDa |
| Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT. |
| Immunogen | PGAM1, 1-254 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Rat Periostin/OSF-2 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant HCoV-229E Nucleocapsid His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Human S100A7 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ Recombinant Human SH3BGRL2 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ GALNTL4 Recombinant Protein Antigen
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Recombinant Protein
R&D Systems™ Recombinant Mouse TrkC Fc Chimera Protein
Measured by its ability to inhibit NT-3-induced proliferation of BaF3 mouse pro-B cells transfected with human TrkB. The ED50 for this effect is 0.05 to 0.3 μg/mL.
R&D Systems™ Recombinant Human GDF-9 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity
| Accession Number | O60383 |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE under reducing conditions and visualized by silver stain. |
| Conjugate | Unconjugated |
| Molecular Weight (g/mol) | 16 kDa (monomer) |
| Quantity | 10 μg |
| Storage Requirements | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution. |
| Source | Human embryonic kidney cell,HEK293-derived human GDF-9 protein Gly320-Arg454 (Gly391Arg) |
| Recombinant | Recombinant |
| Name | GDF-9 |
R&D Systems™ Recombinant SARS-CoV-2 B.1.324.1 Spike (GCN4-IZ) Protein
His-tag. +E484K Point Mutation
Novus Biologicals™ Recombinant Human COMMD7 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Human CGREF1 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Purity or Quality Grade | >85%, by SDS-PAGE |
|---|---|
| Conjugate | Unconjugated |
| Gene Alias | cell growth regulator with EF hand domain protein 1, cell growth regulator with EF-hand domain 1, Cell growth regulatory gene 11 protein, CGR11cell growth regulator with EF hand domain 1, hydrophobestin |
| Common Name | CGREF1 |
| Molecular Weight (g/mol) | TMW: 32.3kDa |
| Gene ID (Entrez) | 10669 |
| Formulation | Phosphate buffered saline (pH7.4) |
| Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 0.5mg/mL |
| For Use With (Application) | SDS-PAGE |
| Recombinant | Recombinant |
R&D Systems™ Recombinant Mouse PDGF R alpha His-tag Protein
The Recombinant Mouse PDGF R alpha His-tag Protein is derived from NS0
Novus Biologicals™ SRP14 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >85% |
| Conjugate | Unconjugated |
| Common Name | SRP14 |
| Molecular Weight (g/mol) | 17.1kDa |
| Formulation | Liquid. 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1.0mg/mL |
| For Use With (Application) | SDS-PAGE |